- Recombinant Schizosaccharomyces pombe Cytochrome oxidase assembly protein 3, mitochondrial (tam3)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1065767
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 7,883 Da
- E Coli or Yeast
- 25204
- Cytochrome oxidase assembly protein 3, mitochondrial (tam3)
Sequence
MNQGNQAFENARKPFRRANLITALGLGAFAFATFAYSVYRVHEDTFEDVVMTPELEKKIAEDRDLSKKN